PTM Viewer PTM Viewer

AT2G24450.1

Arabidopsis thaliana [ath]

FASCICLIN-like arabinogalactan protein 3 precursor

No PTMs currently found

PLAZA: AT2G24450
Gene Family: HOM05D000588
Other Names: FLA3

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 280

MGLKVSSSLLCLTILLAVSSIVSAVNITRVLEKYPEFSTMTELLAKTELTPIINKRQTITVLALNNDAIGSISGRPEEEVKNILMNHVVLDYFDELKLKALKEKSTLLTTLYQSTGLGQQQNGFLNCTKSNGKIYFGSGVKGAPQTAEYITTVFRNPYNLSVVQISMPIVAPGLGSPVKVPPPPPMSSPPAPSPKKGAATPAPAPADEGDYADAPPGLAPETAPASAPSESDSPAPAPDKSGKKKMAAADEAEPPSSASNTGLSFGAVLVLGFVASFVGF

Domains & Sites

Clear highlighted range 
Interpro Domains
Show IPR ID From To
IPR000782 24 141
Molecule Processing
Show Type From To
Propeptide 257 280
Signal Peptide 1 24

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here